Recombinant Human ATF6, GST-tagged

Cat.No. : ATF6-873H
Product Overview : Recombinant Human ATF6 (1 a.a. - 202 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-202 a.a.
Description : ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ERmolecules.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : Theoretical MW (kDa): 48.5
AA Sequence : MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWD INNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT
Applications : AP, Array, ELISA, WB-Re
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name ATF6 activating transcription factor 6 [ Homo sapiens ]
Official Symbol ATF6
Synonyms ATF6A; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha
Gene ID 22926
mRNA Refseq NM_007348
Protein Refseq NP_031374
MIM 605537
UniProt ID P18850
Chromosome Location 1q23.3
Pathway ATF4 activates genes, organism-specific biosystem; Alzheimer's disease, conserved biosystem; Metabolism of proteins, organism-specific biosystem
Function RNA polymerase II regulatory region sequence-specific DNA binding; cAMP response element binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ATF6 Products

Required fields are marked with *

My Review for All ATF6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon