Recombinant Human ATF6, GST-tagged

• Cat.No.: ATF6-873H
• Product Overview: Recombinant Human ATF6 (1 a.a. - 202 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: ATF6 is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ERmolecules.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: Theoretical MW (kDa): 48.5
• AA Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWD INNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT
• Applications: AP, Array, ELISA, WB-Re
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-202 a.a.

Gene Information

• Gene Name: ATF6 activating transcription factor 6 [ Homo sapiens ]
• Official Symbol: ATF6
• Synonyms: ATF6A; cyclic AMP-dependent transcription factor ATF-6 alpha; cAMP-dependent transcription factor ATF-6 alpha
• Gene ID: 22926
• mRNA Refseq: NM_007348
• Protein Refseq: NP_031374
• MIM: 605537
• UniProt ID: P18850
• Chromosome Location: 1q23.3
• Pathway: ATF4 activates genes, organism-specific biosystem; Alzheimer's disease, conserved biosystem; Metabolism of proteins, organism-specific biosystem
• Function: RNA polymerase II regulatory region sequence-specific DNA binding; cAMP response element binding; protein binding