Recombinant Human ATE1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ATE1-6383H |
Product Overview : | ATE1 MS Standard C13 and N15-labeled recombinant protein (NP_008972) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes an arginyltransferase, an enzyme that is involved in posttranslational conjugation of arginine to N-terminal aspartate or glutamate residues. Conjugation of arginine to the N-terminal aspartate or glutamate targets proteins for ubiquitin-dependent degradation. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 59 kDa |
AA Sequence : | MAFWAGGSPSVVDYFPSEDFYRCGYCKNESGSRSNGMWAHSMTVQDYQDLIDRGWRRSGKYVYKPVMNQTCCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTMDDAVAGDFALINKLDIQCDLKTLSDDIKESLESEGKNSKKEEPQELLQSQDFVGEKLGSGEPSHSVKVHTVPKPGKGADLSKPPCRKAKEIRKERKRLKLMQQNPAGELEGFQAQGHPPSLFPPKAKSNQPKSLEDLIFESLPENASHKLEVRLVPVSFEDPEFKSSFSQSFSLYVKYQVAIHQDPPDECGKTEFTRFLCSSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDILPNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMKYKGQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRLQVFHKRAIMPYGVYKKQQKDPSEEAAVLQYASLVGQKCSERMLLFRNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ATE1 arginyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | ATE1 |
Synonyms | ATE1; arginyltransferase 1; arginyl-tRNA--protein transferase 1; R-transferase 1; arginyl-tRNA-protein transferase; arginine-tRNA--protein transferase 1; MGC26724; |
Gene ID | 11101 |
mRNA Refseq | NM_007041 |
Protein Refseq | NP_008972 |
MIM | 607103 |
UniProt ID | O95260 |
◆ Recombinant Proteins | ||
ATE1-5576Z | Recombinant Zebrafish ATE1 | +Inquiry |
ATE1-6383H | Recombinant Human ATE1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATE1-1162HF | Recombinant Full Length Human ATE1 Protein, GST-tagged | +Inquiry |
ATE1-3631H | Recombinant Human ATE1, His-tagged | +Inquiry |
ATE1-935H | Recombinant Human ATE1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATE1-8633HCL | Recombinant Human ATE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATE1 Products
Required fields are marked with *
My Review for All ATE1 Products
Required fields are marked with *
0
Inquiry Basket