Recombinant Human ATCAY protein, GST-tagged

• Cat.No.: ATCAY-934H
• Product Overview: Human ATCAY partial ORF ( NP_149053.1, 3 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33 kDa
• AA Sequence: TTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEI
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATCAY ataxia, cerebellar, Cayman type [ Homo sapiens ]
• Official Symbol: ATCAY
• Synonyms: ATCAY; ataxia, cerebellar, Cayman type; caytaxin; Cayman ataxia; ataxia cayman type protein; CLAC; BNIP-H; KIAA1872
• Gene ID: 85300
• mRNA Refseq: NM_033064
• Protein Refseq: NP_149053
• MIM: 608179
• UniProt ID: Q86WG3