Recombinant Full Length Human ATCAY Protein, C-Flag-tagged
Cat.No. : | ATCAY-316HFL |
Product Overview : | Recombinant Full Length Human ATCAY Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a neuron-restricted protein that contains a CRAL-TRIO motif common to proteins that bind small lipophilic molecules. Mutations in this gene are associated with cerebellar ataxia, Cayman type. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.9 kDa |
AA Sequence : | MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINI SLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGD GTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYI MENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTV LAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKP EVAPVENRSALVSEDQETSMSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | ATCAY ATCAY kinesin light chain interacting caytaxin [ Homo sapiens (human) ] |
Official Symbol | ATCAY |
Synonyms | CLAC; BNIP-H |
Gene ID | 85300 |
mRNA Refseq | NM_033064.5 |
Protein Refseq | NP_149053.1 |
MIM | 608179 |
UniProt ID | Q86WG3 |
◆ Recombinant Proteins | ||
ATCAY-811M | Recombinant Mouse ATCAY Protein, His (Fc)-Avi-tagged | +Inquiry |
ATCAY-493R | Recombinant Rat ATCAY Protein, His (Fc)-Avi-tagged | +Inquiry |
ATCAY-837R | Recombinant Rat ATCAY Protein | +Inquiry |
ATCAY-2816H | Recombinant Human ATCAY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ATCAY-2062M | Recombinant Mouse ATCAY Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATCAY-8634HCL | Recombinant Human ATCAY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATCAY Products
Required fields are marked with *
My Review for All ATCAY Products
Required fields are marked with *
0
Inquiry Basket