Recombinant Human ATAD4 protein, GST-tagged

• Cat.No.: ATAD4-933H
• Product Overview: Human ATAD4 full-length ORF ( NP_077296.1, 1 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: PRR15L (Proline Rich 15 Like) is a Protein Coding gene.
• Molecular Mass: 38.1 kDa
• AA Sequence: MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PRR15L proline rich 15-like [ Homo sapiens ]
• Official Symbol: PRR15L
• Synonyms: ATAD4
• Gene ID: 79170
• mRNA Refseq: NM_024320.3
• Protein Refseq: NP_077296.1
• UniProt ID: Q9BU68