Recombinant Human ASXL1 protein, GST-tagged
Cat.No. : | ASXL1-926H |
Product Overview : | Human ASXL1 full-length ORF ( AAH64984.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Molecular Mass : | 35.9 kDa |
AA Sequence : | MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASXL1 additional sex combs like 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | ASXL1 |
Synonyms | ASXL1; additional sex combs like 1 (Drosophila); putative Polycomb group protein ASXL1; KIAA0978; additional sex combs-like protein 1; MDS; BOPS; MGC71111; MGC117280; |
Gene ID | 171023 |
mRNA Refseq | NM_001164603 |
Protein Refseq | NP_001158075 |
MIM | 612990 |
UniProt ID | Q8IXJ9 |
◆ Recombinant Proteins | ||
ASXL1-2926H | Recombinant Human ASXL1 Protein, GST-tagged | +Inquiry |
ASXL1-9951H | Recombinant Human ASXL1, His-tagged | +Inquiry |
ASXL1-2052M | Recombinant Mouse ASXL1 Protein | +Inquiry |
ASXL1-2928H | Recombinant Human ASXL1 Protein, MYC/DDK-tagged | +Inquiry |
ASXL1-1409HF | Recombinant Full Length Human ASXL1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASXL1 Products
Required fields are marked with *
My Review for All ASXL1 Products
Required fields are marked with *
0
Inquiry Basket