Recombinant Human ASXL1 protein, GST-tagged

Cat.No. : ASXL1-926H
Product Overview : Human ASXL1 full-length ORF ( AAH64984.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]
Molecular Mass : 35.9 kDa
AA Sequence : MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASXL1 additional sex combs like 1 (Drosophila) [ Homo sapiens ]
Official Symbol ASXL1
Synonyms ASXL1; additional sex combs like 1 (Drosophila); putative Polycomb group protein ASXL1; KIAA0978; additional sex combs-like protein 1; MDS; BOPS; MGC71111; MGC117280;
Gene ID 171023
mRNA Refseq NM_001164603
Protein Refseq NP_001158075
MIM 612990
UniProt ID Q8IXJ9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASXL1 Products

Required fields are marked with *

My Review for All ASXL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon