Recombinant Human ASRGL1 protein, GST-tagged

Cat.No. : ASRGL1-921H
Product Overview : Human ASRGL1 full-length ORF ( AAH64963, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ASRGL1 (Asparaginase Like 1) is a Protein Coding gene. Among its related pathways are Metabolism and Histidine, lysine, phenylalanine, tyrosine, proline and tryptophan catabolism. GO annotations related to this gene include hydrolase activity and asparaginase activity. An important paralog of this gene is TASP1.
Molecular Mass : 45.54 kDa
AA Sequence : MGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASRGL1 asparaginase like 1 [ Homo sapiens (human) ]
Official Symbol ASRGL1
Synonyms ASRGL1; asparaginase like 1; ALP; ALP1; CRASH; isoaspartyl peptidase/L-asparaginase; L-asparaginase; L-asparagine amidohydrolase; asparaginase-like 1 protein; asparaginase-like protein 1; beta-aspartyl-peptidase; isoaspartyl dipeptidase; testis secretory sperm-binding protein Li 242mP; EC 3.4.19.5; EC 3.5.1.1
Gene ID 114242
mRNA Refseq NM_001083926
Protein Refseq NP_001077395
MIM 609212
UniProt ID Q7L266

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASRGL1 Products

Required fields are marked with *

My Review for All ASRGL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon