Recombinant Human ASPDH Protein, GST-tagged

Cat.No. : ASPDH-4770H
Product Overview : Human LOC554235 full-length ORF ( NP_001019827.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ASPDH (Aspartate Dehydrogenase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and aspartate dehydrogenase activity.
Molecular Mass : 45.1 kDa
AA Sequence : MGDRVKGSKSRRPDLVVEVAHPKIIHESGAQILRHANLLSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWRSLLACCQLPSRPGIHLC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ASPDH aspartate dehydrogenase domain containing [ Homo sapiens (human) ]
Official Symbol ASPDH
Synonyms ASPDH; aspartate dehydrogenase domain containing; putative L-aspartate dehydrogenase; aspartate dehydrogenase domain-containing protein; EC 1.4.1.21
Gene ID 554235
mRNA Refseq NM_001024656
Protein Refseq NP_001019827
UniProt ID A6ND91

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASPDH Products

Required fields are marked with *

My Review for All ASPDH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon