Recombinant Full Length Human ASPDH Protein, GST-tagged

• Cat.No.: ASPDH-5906HF
• Product Overview: Human LOC554235 full-length ORF ( NP_001019827.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 178 amino acids
• Description: ASPDH (Aspartate Dehydrogenase Domain Containing) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and aspartate dehydrogenase activity.
• Molecular Mass: 45.1 kDa
• AA Sequence: MGDRVKGSKSRRPDLVVEVAHPKIIHESGAQILRHANLLSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVIGVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWRSLLACCQLPSRPGIHLC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASPDH aspartate dehydrogenase domain containing [ Homo sapiens (human) ]
• Official Symbol: ASPDH
• Synonyms: ASPDH; aspartate dehydrogenase domain containing; putative L-aspartate dehydrogenase; aspartate dehydrogenase domain-containing protein; EC 1.4.1.21
• Gene ID: 554235
• mRNA Refseq: NM_001024656
• Protein Refseq: NP_001019827
• UniProt ID: A6ND91