Recombinant Human ASMT protein, His&Myc-tagged

• Cat.No.: ASMT-2558H
• Product Overview: Recombinant Human ASMT protein(P46597)(1-345aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.9 kDa
• Protein length: 1-345aa
• AA Sequence: MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ASMT acetylserotonin O-methyltransferase [ Homo sapiens ]
• Official Symbol: ASMT
• Synonyms: ASMT; acetylserotonin O-methyltransferase; ASMTY; HIOMT; HIOMTY; hydroxyindole O-methyltransferase; acetylserotonin N-methyltransferase; acetylserotonin methyltransferase (Y chromosome)
• Gene ID: 438
• mRNA Refseq: NM_001171038
• Protein Refseq: NP_001164509
• MIM: 300015
• UniProt ID: P46597