Recombinant Human ASMT protein, GST-tagged

• Cat.No.: ASMT-910H
• Product Overview: Human ASMT full-length ORF ( AAH01620.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene belongs to the methyltransferase superfamily, and is located in the pseudoautosomal region (PAR) at the end of the short arms of the X and Y chromosomes. The encoded enzyme catalyzes the final reaction in the synthesis of melatonin, and is abundant in the pineal gland. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.6 kDa
• AA Sequence: MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASMT acetylserotonin O-methyltransferase [ Homo sapiens ]
• Official Symbol: ASMT
• Synonyms: ASMT; acetylserotonin O-methyltransferase; ASMTY; HIOMT; HIOMTY; hydroxyindole O-methyltransferase; acetylserotonin N-methyltransferase; acetylserotonin methyltransferase (Y chromosome)
• Gene ID: 438
• mRNA Refseq: NM_001171038
• Protein Refseq: NP_001164509
• MIM: 300015
• UniProt ID: P46597