Recombinant Human ASK protein, GST-tagged

• Cat.No.: ASK-908H
• Product Overview: Human ASK partial ORF ( NP_006707, 2 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DBF4 (DBF4 Zinc Finger) is a Protein Coding gene. Among its related pathways are Regulation of activated PAK-2p34 by proteasome mediated degradation and Mitotic G1-G1/S phases. GO annotations related to this gene include nucleic acid binding and enzyme activator activity. An important paralog of this gene is DBF4B.
• Molecular Mass: 36.41 kDa
• AA Sequence: NSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTISEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DBF4 DBF4 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: DBF4
• Synonyms: DBF4; DBF4 homolog (S. cerevisiae); protein DBF4 homolog A; activator of S phase kinase; ASK; chif; chiffon homolog (Drosophila); DBF4A; ZDBF1; zinc finger; DBF type containing 1; chiffon homolog A; zinc finger, DBF-type containing 1; DBF4-type zinc finger-containing protein 1; CHIF
• Gene ID: 10926
• mRNA Refseq: NM_006716
• Protein Refseq: NP_006707
• MIM: 604281
• UniProt ID: Q9UBU7