Recombinant Human ASGR1 protein(71-150 aa), C-hFc & C-His-tagged

• Cat.No.: ASGR1-2580H
• Product Overview: Recombinant Human ASGR1 protein(P07306)(71-150 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: C-hFc & C-His
• Protein length: 71-150 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: RGLRETFSNFTASTEAQVKGLSTQGGNVGRKMKSLESQLEKQQKDLSEDHSSLLLHVKQFVSDLRSLSCQMAALQGNGSE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ASGR1 asialoglycoprotein receptor 1 [ Homo sapiens ]
• Official Symbol: ASGR1
• Synonyms: ASGR1; asialoglycoprotein receptor 1; CLEC4H1; hepatic lectin H1; C-type lectin domain family 4 member H1; HL-1; ASGPR; ASGPR1
• Gene ID: 432
• mRNA Refseq: NM_001197216
• Protein Refseq: NP_001184145
• MIM: 108360
• UniProt ID: P07306