Recombinant Human ASF1A protein, T7/His-tagged

Cat.No. : ASF1A-197H
Product Overview : Recombinant human ASF1a (204 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGEFAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSA ESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELR ENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLE SHMDCM
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol ASF1A
Synonyms ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146;
Gene ID 25842
mRNA Refseq NM_014034
Protein Refseq NP_054753
MIM 609189
UniProt ID Q9Y294
Chromosome Location 6q22.31
Function chromatin binding; histone binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ASF1A Products

Required fields are marked with *

My Review for All ASF1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon