Recombinant Human ASF1A protein, T7/His-tagged

• Cat.No.: ASF1A-197H
• Product Overview: Recombinant human ASF1a (204 aa) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&T7
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSA ESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELR ENPPVKPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSNPNLQSLLSTDALPSASKGWSTSENSLNVMLE SHMDCM
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: ASF1A ASF1 anti-silencing function 1 homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ASF1A
• Synonyms: ASF1A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; CIA; DKFZP547E2110; hCIA; hAsf1; hAsf1a; CCG1-interacting factor A; anti-silencing function 1A; anti-silencing function protein 1 homolog A; CGI-98; HSPC146
• Gene ID: 25842
• mRNA Refseq: NM_014034
• Protein Refseq: NP_054753
• MIM: 609189
• UniProt ID: Q9Y294
• Chromosome Location: 6q22.31
• Function: chromatin binding; histone binding; protein binding