Recombinant Human ASB13 protein, GST-tagged

• Cat.No.: ASB13-886H
• Product Overview: Human ASB13 full-length ORF ( NP_078977.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants, both protein-coding and not protein-coding, have been described for this gene. [provided by RefSeq, Nov 2010]
• Molecular Mass: 56.4 kDa
• AA Sequence: MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ASB13 ankyrin repeat and SOCS box containing 13 [ Homo sapiens ]
• Official Symbol: ASB13
• Synonyms: ASB13; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; FLJ13134; MGC19879; ankyrin repeat and SOCS box-containing 13; ankyrin repeat domain-containing SOCS box protein Asb-13
• Gene ID: 79754
• mRNA Refseq: NM_024701
• Protein Refseq: NP_078977
• UniProt ID: Q8WXK3