Recombinant Human ASB11 protein, His-SUMO-tagged
Cat.No. : | ASB11-6743H |
Product Overview : | Recombinant Human ASB11 protein(Q8WXH4)(1-323aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-323a.a. |
Tag : | His&SUMO |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ |
Gene Name | ASB11 ankyrin repeat and SOCS box containing 11 [ Homo sapiens ] |
Official Symbol | ASB11 |
Synonyms | ASB11; ankyrin repeat and SOCS box containing 11; ankyrin repeat and SOCS box protein 11; DKFZp779E2460; ASB-11; ankyrin repeat domain-containing SOCS box protein ASB11; MGC119168; MGC119169; |
Gene ID | 140456 |
mRNA Refseq | NM_001012428 |
Protein Refseq | NP_001012428 |
MIM | 300626 |
UniProt ID | Q8WXH4 |
◆ Recombinant Proteins | ||
ASB11-422R | Recombinant Rhesus monkey ASB11 Protein, His-tagged | +Inquiry |
ASB11-2007M | Recombinant Mouse ASB11 Protein | +Inquiry |
ASB11-1355HF | Recombinant Full Length Human ASB11 Protein, GST-tagged | +Inquiry |
ASB11-774M | Recombinant Mouse ASB11 Protein, His (Fc)-Avi-tagged | +Inquiry |
ASB11-12807Z | Recombinant Zebrafish ASB11 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASB11 Products
Required fields are marked with *
My Review for All ASB11 Products
Required fields are marked with *
0
Inquiry Basket