Recombinant Human ASB11 protein, His-SUMO-tagged

• Cat.No.: ASB11-6743H
• Product Overview: Recombinant Human ASB11 protein(Q8WXH4)(1-323aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His&SUMO
• Protein length: 1-323a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.3 kDa
• AASequence: MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: ASB11 ankyrin repeat and SOCS box containing 11 [ Homo sapiens ]
• Official Symbol: ASB11
• Synonyms: ASB11; ankyrin repeat and SOCS box containing 11; ankyrin repeat and SOCS box protein 11; DKFZp779E2460; ASB-11; ankyrin repeat domain-containing SOCS box protein ASB11; MGC119168; MGC119169
• Gene ID: 140456
• mRNA Refseq: NM_001012428
• Protein Refseq: NP_001012428
• MIM: 300626
• UniProt ID: Q8WXH4