Recombinant Human ASB11 protein, GST-tagged
Cat.No. : | ASB11-884H |
Product Overview : | Human ASB11 full-length ORF ( NP_543149.1, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011] |
Molecular Mass : | 61.8 kDa |
AA Sequence : | MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASB11 ankyrin repeat and SOCS box containing 11 [ Homo sapiens ] |
Official Symbol | ASB11 |
Synonyms | ASB11; ankyrin repeat and SOCS box containing 11; ankyrin repeat and SOCS box protein 11; DKFZp779E2460; ASB-11; ankyrin repeat domain-containing SOCS box protein ASB11; MGC119168; MGC119169; |
Gene ID | 140456 |
mRNA Refseq | NM_001012428 |
Protein Refseq | NP_001012428 |
MIM | 300626 |
UniProt ID | Q8WXH4 |
◆ Recombinant Proteins | ||
ASB11-1355HF | Recombinant Full Length Human ASB11 Protein, GST-tagged | +Inquiry |
ASB11-12807Z | Recombinant Zebrafish ASB11 | +Inquiry |
ASB11-422R | Recombinant Rhesus monkey ASB11 Protein, His-tagged | +Inquiry |
ASB11-349H | Recombinant Human ASB11 Protein, His-tagged | +Inquiry |
ASB11-01H | Recombinant Human ASB11 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASB11 Products
Required fields are marked with *
My Review for All ASB11 Products
Required fields are marked with *
0
Inquiry Basket