Recombinant Human ASAH2B Protein (1-165 aa), His-tagged
Cat.No. : | ASAH2B-1336H |
Product Overview : | Recombinant Human ASAH2B Protein (1-165 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-165 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 21.0 kDa |
AA Sequence : | MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ASAH2B N-acylsphingosine amidohydrolase 2B [ Homo sapiens (human) ] |
Official Symbol | ASAH2B |
Synonyms | ASAH2C; ASAH2L; bA98I6.3; bA449O16.3; |
Gene ID | 653308 |
UniProt ID | P0C7U1 |
◆ Recombinant Proteins | ||
ASAH2B-340H | Recombinant Human ASAH2B Protein (1-165 aa), His-tagged | +Inquiry |
ASAH2B-1336H | Recombinant Human ASAH2B Protein (1-165 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ASAH2B Products
Required fields are marked with *
My Review for All ASAH2B Products
Required fields are marked with *
0
Inquiry Basket