Recombinant Human ASAH2B Protein (1-165 aa), His-tagged

• Cat.No.: ASAH2B-1336H
• Product Overview: Recombinant Human ASAH2B Protein (1-165 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length.

Specification

• Source: Yeast
• Species: Human
• Tag: His
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.0 kDa
• Protein length: 1-165 aa
• AA Sequence: MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ASAH2B N-acylsphingosine amidohydrolase 2B [ Homo sapiens (human) ]
• Official Symbol: ASAH2B
• Synonyms: ASAH2C; ASAH2L; bA98I6.3; bA449O16.3
• Gene ID: 653308
• UniProt ID: P0C7U1