Recombinant Human ART4 protein, GST-tagged

Cat.No. : ART4-301319H
Product Overview : Recombinant Human ART4 (1-60 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Met1-Gly60
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : MGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTEGSEVAIKIDFDFAPG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name ART4 ADP-ribosyltransferase 4 (Dombrock blood group) [ Homo sapiens ]
Official Symbol ART4
Synonyms ART4; ADP-ribosyltransferase 4 (Dombrock blood group); ADP ribosyltransferase 4 , ADP ribosyltransferase 4 (DO blood group) , DO, Dombrock blood group; ecto-ADP-ribosyltransferase 4; CD297; DOK1; mono-ADP-ribosyltransferase 4; mono(ADP-ribosyl)transferase 4; Dombrock blood group carrier molecule; ADP-ribosyltransferase 4 (DO blood group); NAD(P)(+)--arginine ADP-ribosyltransferase 4; DO;
Gene ID 420
mRNA Refseq NM_021071
Protein Refseq NP_066549
UniProt ID Q93070

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ART4 Products

Required fields are marked with *

My Review for All ART4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon