Recombinant Human ARSJ protein, GST-tagged
Cat.No. : | ARSJ-867H |
Product Overview : | Human ARSJ full-length ORF ( AAH32010.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Sulfatases (EC 3.1.5.6), such as ARSJ, hydrolyze sulfate esters from sulfated steroids, carbohydrates, proteoglycans, and glycolipids. They are involved in hormone biosynthesis, modulation of cell signaling, and degradation of macromolecules (Sardiello et al., 2005 [PubMed 16174644]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 35.2 kDa |
AA Sequence : | MAPGQQAMGSGTLQSSQPSECSTGNCLQEILATATGSPLSLSATWDRTGGTMNGSPCQLAKVYGFSTSQPTHMRGWTYLTGIQES |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARSJ arylsulfatase family, member J [ Homo sapiens ] |
Official Symbol | ARSJ |
Synonyms | ARSJ; arylsulfatase family, member J; ASJ; arylsulfatase J; EC 3.1.6.12 |
Gene ID | 79642 |
mRNA Refseq | NM_024590.3 |
Protein Refseq | NP_078866.3 |
MIM | 610010 |
UniProt ID | Q5FYB0 |
◆ Recombinant Proteins | ||
ARSJ-6753H | Recombinant Human ARSJ protein, His-tagged | +Inquiry |
ARSJ-867H | Recombinant Human ARSJ protein, GST-tagged | +Inquiry |
ARSJ-1302HF | Recombinant Full Length Human ARSJ Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSJ-8674HCL | Recombinant Human ARSJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSJ Products
Required fields are marked with *
My Review for All ARSJ Products
Required fields are marked with *
0
Inquiry Basket