Recombinant Human ARPP-19 protein, GST-tagged
Cat.No. : | ARPP-19-853H |
Product Overview : | Human ARPP-19 full-length ORF ( AAH03418, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-112 a.a. |
Description : | The 19-kD cAMP-regulated phosphoprotein plays a role in regulating mitosis by inhibiting protein phosphatase-2A (PP2A; see MIM 176915) (summary by Gharbi-Ayachi et al., 2010 [PubMed 21164014]).[supplied by OMIM, Feb 2011] |
Molecular Mass : | 38.06 kDa |
AA Sequence : | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARPP19 cAMP-regulated phosphoprotein, 19kDa [ Homo sapiens(human) ] |
Official Symbol | ARPP19 |
Synonyms | ARPP19; ENSAL; ARPP16; ARPP-16; ARPP-19; cAMP-regulated phosphoprotein, 19kDa; cAMP-regulated phosphoprotein 19; cyclic AMP phosphoprotein, 19 kD |
Gene ID | 10776 |
mRNA Refseq | NM_006628 |
Protein Refseq | NP_006619 |
MIM | 605487 |
UniProt ID | P56211 |
◆ Recombinant Proteins | ||
ARPP19-247R | Recombinant Rhesus Macaque ARPP19 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARPP19-2449H | Recombinant human ARPP19, His-tagged | +Inquiry |
ARPP19-418R | Recombinant Rhesus monkey ARPP19 Protein, His-tagged | +Inquiry |
ARPP19-457R | Recombinant Rat ARPP19 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARPP19-801R | Recombinant Rat ARPP19 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPP19-8681HCL | Recombinant Human ARPP19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARPP19 Products
Required fields are marked with *
My Review for All ARPP19 Products
Required fields are marked with *
0
Inquiry Basket