Recombinant Human ARPP-19 protein, GST-tagged

• Cat.No.: ARPP-19-853H
• Product Overview: Human ARPP-19 full-length ORF ( AAH03418, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The 19-kD cAMP-regulated phosphoprotein plays a role in regulating mitosis by inhibiting protein phosphatase-2A (PP2A; see MIM 176915) (summary by Gharbi-Ayachi et al., 2010 [PubMed 21164014]).[supplied by OMIM, Feb 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 38.06 kDa
• AA Sequence: MSAEVPEAASAEEQKEMEDKVTSPEKAEEAKLKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAKAKMKNKQLPTAAPDKTEVTGDHIPTPQDLPQRKPSLVASKLAG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 1-112 a.a.

Gene Information

• Gene Name: ARPP19 cAMP-regulated phosphoprotein, 19kDa [ Homo sapiens(human) ]
• Official Symbol: ARPP19
• Synonyms: ARPP19; ENSAL; ARPP16; ARPP-16; ARPP-19; cAMP-regulated phosphoprotein, 19kDa; cAMP-regulated phosphoprotein 19; cyclic AMP phosphoprotein, 19 kD
• Gene ID: 10776
• mRNA Refseq: NM_006628
• Protein Refseq: NP_006619
• MIM: 605487
• UniProt ID: P56211