Recombinant Human ARPC5L protein, GST-tagged

• Cat.No.: ARPC5L-850H
• Product Overview: Human ARPC5L full-length ORF ( NP_112240.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARPC5L (Actin Related Protein 2/3 Complex Subunit 5 Like) is a Protein Coding gene. Among its related pathways are Development Slit-Robo signaling and Salmonella infection (KEGG). GO annotations related to this gene include actin binding. An important paralog of this gene is ARPC5.
• Molecular Mass: 43.3 kDa
• AA Sequence: MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARPC5L actin related protein 2/3 complex subunit 5 like [ Homo sapiens (human) ]
• Official Symbol: ARPC5L
• Synonyms: ARPC5L; actin related protein 2/3 complex subunit 5 like; ARC16-2; actin-related protein 2/3 complex subunit 5-like protein; arp2/3 complex 16 kDa subunit 2
• Gene ID: 81873
• mRNA Refseq: NM_030978
• Protein Refseq: NP_112240
• UniProt ID: Q9BPX5