Recombinant Human ARPC5L protein, GST-tagged

Cat.No. : ARPC5L-850H
Product Overview : Human ARPC5L full-length ORF ( NP_112240.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARPC5L (Actin Related Protein 2/3 Complex Subunit 5 Like) is a Protein Coding gene. Among its related pathways are Development Slit-Robo signaling and Salmonella infection (KEGG). GO annotations related to this gene include actin binding. An important paralog of this gene is ARPC5.
Molecular Mass : 43.3 kDa
AA Sequence : MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARPC5L actin related protein 2/3 complex subunit 5 like [ Homo sapiens (human) ]
Official Symbol ARPC5L
Synonyms ARPC5L; actin related protein 2/3 complex subunit 5 like; ARC16-2; actin-related protein 2/3 complex subunit 5-like protein; arp2/3 complex 16 kDa subunit 2
Gene ID 81873
mRNA Refseq NM_030978
Protein Refseq NP_112240
UniProt ID Q9BPX5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARPC5L Products

Required fields are marked with *

My Review for All ARPC5L Products

Required fields are marked with *

0

Inquiry Basket

cartIcon