Recombinant Human ARPC3 protein, GST-tagged

• Cat.No.: ARPC3-847H
• Product Overview: Human ARPC3 full-length ORF ( NP_005710.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46.9 kDa
• AA Sequence: MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa [ Homo sapiens ]
• Official Symbol: ARPC3
• Synonyms: ARPC3; actin related protein 2/3 complex, subunit 3, 21kDa; actin related protein 2/3 complex, subunit 3 (21 kD); actin-related protein 2/3 complex subunit 3; ARC21; p21 Arc; arp2/3 complex 21 kDa subunit; ARP2/3 protein complex subunit p21; p21-Arc
• Gene ID: 10094
• mRNA Refseq: NM_005719
• Protein Refseq: NP_005710
• MIM: 604225
• UniProt ID: O15145