Recombinant Human ARPC3 protein, GST-tagged
Cat.No. : | ARPC3-847H |
Product Overview : | Human ARPC3 full-length ORF ( NP_005710.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been conserved through evolution and is implicated in the control of actin polymerization in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2013] |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARPC3 actin related protein 2/3 complex, subunit 3, 21kDa [ Homo sapiens ] |
Official Symbol | ARPC3 |
Synonyms | ARPC3; actin related protein 2/3 complex, subunit 3, 21kDa; actin related protein 2/3 complex, subunit 3 (21 kD); actin-related protein 2/3 complex subunit 3; ARC21; p21 Arc; arp2/3 complex 21 kDa subunit; ARP2/3 protein complex subunit p21; p21-Arc; |
Gene ID | 10094 |
mRNA Refseq | NM_005719 |
Protein Refseq | NP_005710 |
MIM | 604225 |
UniProt ID | O15145 |
◆ Recombinant Proteins | ||
ARPC3-5659H | Recombinant Human ARPC3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARPC3-342Z | Recombinant Zebrafish ARPC3 | +Inquiry |
ARPC3-1968M | Recombinant Mouse ARPC3 Protein | +Inquiry |
ARPC3-847H | Recombinant Human ARPC3 protein, GST-tagged | +Inquiry |
ARPC3-2793H | Recombinant Human ARPC3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARPC3-37HCL | Recombinant Human ARPC3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARPC3 Products
Required fields are marked with *
My Review for All ARPC3 Products
Required fields are marked with *
0
Inquiry Basket