Recombinant Human ARPC1B protein, His-tagged

• Cat.No.: ARPC1B-3841H
• Product Overview: Recombinant Human ARPC1B protein(265-372 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 265-372 aa
• AA Sequence: CFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARERFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVKSLESALKDLKIK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ARPC1B actin related protein 2/3 complex, subunit 1B, 41kDa [ Homo sapiens ]
• Official Symbol: ARPC1B
• Synonyms: ARPC1B; actin related protein 2/3 complex, subunit 1B, 41kDa; actin related protein 2/3 complex, subunit 1B (41 kD); actin-related protein 2/3 complex subunit 1B; actin related protein 2/3 complex; subunit 1A (41 kD); ARC41; ARP2/3 protein complex subunit p41; p40 ARC; p41 ARC; arp2/3 complex 41 kDa subunit; p40-ARC; p41-ARC
• Gene ID: 10095
• mRNA Refseq: NM_005720
• Protein Refseq: NP_005711
• MIM: 604223
• UniProt ID: O15143