Recombinant Human ARMC7 protein, GST-tagged

• Cat.No.: ARMC7-830H
• Product Overview: Human ARMC7 full-length ORF ( NP_078861.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARMC7 (Armadillo Repeat Containing 7) is a Protein Coding gene. GO annotations related to this gene include binding.
• Molecular Mass: 48.3 kDa
• AA Sequence: MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQVLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEENETLVEFAIGGLCNLCPDRANKEHILHAGGVPLIINCLSSPNEETVLSAITTLMHLSPPGRSFLPELTATPVVQCMLRFSLSASARLRNLAQIFLEDFCSPRQVAEARSRQAHSALGIPLPRSVAPRQR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARMC7 armadillo repeat containing 7 [ Homo sapiens ]
• Official Symbol: ARMC7
• Synonyms: ARMC7; armadillo repeat containing 7; armadillo repeat-containing protein 7
• Gene ID: 79637
• mRNA Refseq: NM_024585.2
• Protein Refseq: NP_078861.1
• UniProt ID: Q9H6L4