Recombinant Human ARL8B protein, GST-tagged

• Cat.No.: ARL8B-301538H
• Product Overview: Recombinant Human ARL8B (1-186 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ser186
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization
• AA Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: ARL8B ADP-ribosylation factor-like 8B [ Homo sapiens ]
• Official Symbol: ARL8B
• Synonyms: ARL8B; ADP-ribosylation factor-like 8B; ADP ribosylation factor like 10C , ARL10C; ADP-ribosylation factor-like protein 8B; FLJ10702; Gie1; ADP-ribosylation factor-like 10C; ADP-ribosylation factor-like protein 10C; novel small G protein indispensable for equal chromosome segregation 1; ARL10C
• Gene ID: 55207
• mRNA Refseq: NM_018184
• Protein Refseq: NP_060654
• UniProt ID: Q9NVJ2