Recombinant Human ARL6IP6 protein, GST-tagged

• Cat.No.: ARL6IP6-821H
• Product Overview: Human ARL6IP6 full-length ORF ( NP_689735.1, 1 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ARL6IP6 (ADP Ribosylation Factor Like GTPase 6 Interacting Protein 6) is a Protein Coding gene. Diseases associated with ARL6IP6 include Cutis Marmorata Telangiectatica Congenita.
• Molecular Mass: 51.1 kDa
• AA Sequence: MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLSILCSLLFAILLAFLLAIAYLIVKELHAENLKNEDDVDTGLLGFWTLLIISLTAGFSCCSFSWTVTYFDSFEPGMFPPTPLSPARFKKLTGHSFHMGYSMAILNGIVAALTVAWCLM
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL6IP6 ADP-ribosylation-like factor 6 interacting protein 6 [ Homo sapiens ]
• Official Symbol: ARL6IP6
• Synonyms: ADP ribosylation like factor 6 interacting protein 6; ADP-ribosylation factor-like protein 6-interacting protein 6; Aip-6; AR6P6_HUMAN; ARL-6-interacting protein 6; ARL6IP6; PFAAP1; Phosphonoformate immuno-associated protein 1; Regulated by phosphonoformate; ARL6IP6
• Gene ID: 151188
• mRNA Refseq: NM_152522.5
• Protein Refseq: NP_689735.1
• UniProt ID: B3KMZ5