Recombinant Human ARL6IP4 protein, GST-tagged

• Cat.No.: ARL6IP4-819H
• Product Overview: Human ARL6IP4 partial ORF ( NP_061164, 261 a.a. - 360 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ARL6IP4 (ADP Ribosylation Factor Like GTPase 6 Interacting Protein 4) is a Protein Coding gene. GO annotations related to this gene include poly(A) RNA binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: PGPSLDQWHRSAGEEEDGPVLTDEQKSRIQAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLLP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL6IP4 ADP-ribosylation-like factor 6 interacting protein 4 [ Homo sapiens ]
• Official Symbol: ARL6IP4
• Synonyms: ARL6IP4; ADP-ribosylation-like factor 6 interacting protein 4; ADP-ribosylation factor-like protein 6-interacting protein 4; SFRS20; splicing factor; arginine/serine rich 20; SR 25; SRp25; SRp25 nuclear protein; SRrp37; SR-15; aip-4; HSP-975; HSVI binding protein; HSVI-binding protein; splicing regulator SRrp38; ARL-6-interacting protein 4; splicing factor, arginine/serine-rich 20; SR-25; MGC814
• Gene ID: 51329
• mRNA Refseq: NM_001002251
• Protein Refseq: NP_001002251
• MIM: 607668
• UniProt ID: Q66PJ3