Recombinant Human ARL6 protein, GST-tagged

• Cat.No.: ARL6-816H
• Product Overview: Human ARL6 full-length ORF ( AAH24239, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene belongs to the ARF-like (ADP ribosylation factor-like) sub-family of the ARF family of GTP-binding proteins which are involved in regulation of intracellular traffic. Mutations in this gene are associated with Bardet-Biedl syndrome (BBS). A vision-specific transcript, encoding long isoform BBS3L, has been described (PMID: 20333246). [provided by RefSeq, Apr 2016]
• Molecular Mass: 46.2 kDa
• AA Sequence: MGLLDRLSVLLGLKKKEVHVLCLGLDNSGKTTIINKLKPSNAQSQNILPTIGFSIEKFKSSSLSFTVFDMSGQGRYRNLWEHYYKEGQAIIFVIDSSDRLRMVVAKEELDTLLNHPDIKHRRIPILFFANKMDLRDAVTSVKVSQLLCLENIKDKPWHICASDAIKGEGLQEGVDWLQDQIQTVKT
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL6 ADP ribosylation factor like GTPase 6 [ Homo sapiens (human) ]
• Official Symbol: ARL6
• Synonyms: ARL6; ADP ribosylation factor like GTPase 6; BBS3; RP55; ADP-ribosylation factor-like protein 6; Bardet-Biedl syndrome 3 protein
• Gene ID: 84100
• mRNA Refseq: NM_001278293
• Protein Refseq: NP_001265222
• MIM: 608845
• UniProt ID: Q9H0F7