Recombinant Human ARL5 protein, GST-tagged
Cat.No. : | ARL5-814H |
Product Overview : | Human ARL5 full-length ORF ( AAH01254, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.43 kDa |
AA Sequence : | MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ] |
Official Symbol | ARL5A |
Synonyms | ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5; |
Gene ID | 26225 |
mRNA Refseq | NM_001037174 |
Protein Refseq | NP_001032251 |
MIM | 608960 |
UniProt ID | Q9Y689 |
◆ Recombinant Proteins | ||
ARL5A-4878H | Recombinant Human ARL5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL5A-1196HF | Recombinant Full Length Human ARL5A Protein, GST-tagged | +Inquiry |
Arl5a-1708M | Recombinant Mouse Arl5a Protein, Myc/DDK-tagged | +Inquiry |
ARL5A-784R | Recombinant Rat ARL5A Protein | +Inquiry |
ARL5A-26181TH | Recombinant Human ARL5A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL5A-8710HCL | Recombinant Human ARL5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARL5A Products
Required fields are marked with *
My Review for All ARL5A Products
Required fields are marked with *
0
Inquiry Basket