Recombinant Human ARL5 protein, GST-tagged

• Cat.No.: ARL5-814H
• Product Overview: Human ARL5 full-length ORF ( AAH01254, 1 a.a. - 179 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.43 kDa
• AA Sequence: MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL5A ADP-ribosylation factor-like 5A [ Homo sapiens ]
• Official Symbol: ARL5A
• Synonyms: ARL5A; ADP-ribosylation factor-like 5A; ADP ribosylation factor like 5 , ARL5; ADP-ribosylation factor-like protein 5A; ADP-ribosylation factor-like 5; ADP-ribosylation factor-like protein 5; ARL5; ARFLP5
• Gene ID: 26225
• mRNA Refseq: NM_001037174
• Protein Refseq: NP_001032251
• MIM: 608960
• UniProt ID: Q9Y689