Recombinant Human ARL3 protein, GST-tagged

• Cat.No.: ARL3-810H
• Product Overview: Human ARL3 full-length ORF ( AAH09841, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 45.76 kDa
• AA Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ]
• Official Symbol: ARL3
• Synonyms: ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3; ARF-like 3
• Gene ID: 403
• mRNA Refseq: NM_004311
• Protein Refseq: NP_004302
• MIM: 604695
• UniProt ID: P36405