Recombinant Human ARL3, His-tagged

• Cat.No.: ARL3-26179TH
• Product Overview: Recombinant full-length Human ARL3 with a N terminal His tag. 206 amino acids with a predicted MWt 23 kDa including tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 182 amino acids
• Description: ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity.
• Conjugation: HIS
• Molecular Weight: 23.000kDa inclusive of tags
• Tissue specificity: Expressed in the retina. Strongly expressed in connecting cilium, the myoid region of the inner segments (IS) and in cone photoreceptors (at protein level).
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 30% Glycerol, 0.58% Sodium chloride, 0.02% DTT, 0.002% PMSF
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGSHMGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK
• Sequence Similarities: Belongs to the small GTPase superfamily. Arf family.

Gene Information

• Gene Name: ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ]
• Official Symbol: ARL3
• Synonyms: ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3
• Gene ID: 403
• mRNA Refseq: NM_004311
• Protein Refseq: NP_004302
• MIM: 604695
• Uniprot ID: P36405
• Chromosome Location: 10q23.3
• Function: GDP binding; GTP binding; metal ion binding; microtubule binding; nucleotide binding