Recombinant Human ARL13B protein, GST-tagged

• Cat.No.: ARL13B-805H
• Product Overview: Human ARL13B partial ORF ( NP_878899.1, 329 a.a. - 428 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the ADP-ribosylation factor-like family. The encoded protein is a small GTPase that contains both N-terminal and C-terminal guanine nucleotide-binding motifs. This protein is localized in the cilia and plays a role in cilia formation and in maintenance of cilia. Mutations in this gene are the cause of Joubert syndrome 8. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
• Molecular Mass: 36.74 kDa
• AA Sequence: KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL13B ADP-ribosylation factor-like 13B [ Homo sapiens ]
• Official Symbol: ARL13B
• Synonyms: ARL13B; ADP-ribosylation factor-like 13B; ADP ribosylation factor like 2 like 1 , ARL2L1; ADP-ribosylation factor-like protein 13B; DKFZp761H079; JBTS8; ARL2-like protein 1; ADP-ribosylation factor-like 2-like 1; ARL2L1; MGC120611; MGC120612; DKFZp686E2075; DKFZp686L2472; DKFZp686M2074
• Gene ID: 200894
• mRNA Refseq: NM_001174150
• Protein Refseq: NP_001167621
• MIM: 608922
• UniProt ID: Q3SXY8