Recombinant Human ARL11 protein, GST-tagged

Cat.No. : ARL11-804H
Product Overview : Human ARL11 full-length ORF ( NP_612459.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]
Molecular Mass : 47.8 kDa
AA Sequence : MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARL11 ADP-ribosylation factor-like 11 [ Homo sapiens ]
Official Symbol ARL11
Synonyms ARL11; ADP-ribosylation factor-like 11; ADP-ribosylation factor-like protein 11; ARLTS1; FLJ33930; ADP-ribosylation factor-like tumor suppressor protein 1; MGC17429;
Gene ID 115761
mRNA Refseq NM_138450
Protein Refseq NP_612459
MIM 609351
UniProt ID Q969Q4

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARL11 Products

Required fields are marked with *

My Review for All ARL11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon