Recombinant Human ARL11 protein, GST-tagged

• Cat.No.: ARL11-804H
• Product Overview: Human ARL11 full-length ORF ( NP_612459.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a tumor suppressor related to the ADP-ribosylation factor (ARF) family of proteins. The encoded protein may play a role in apoptosis in a caspase-dependent manner. Polymorphisms in this gene have been associated with some familial cancers. [provided by RefSeq, May 2010]
• Molecular Mass: 47.8 kDa
• AA Sequence: MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGHQLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPLRASWKDYLEGTDILVYVLDSTDEARLPESAAELTEVLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLSLERFQDHCWELRGCSALTGEGLPEALQSLWSLLKSRSCMCLQARAHGAERGDSKRS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL11 ADP-ribosylation factor-like 11 [ Homo sapiens ]
• Official Symbol: ARL11
• Synonyms: ARL11; ADP-ribosylation factor-like 11; ADP-ribosylation factor-like protein 11; ARLTS1; FLJ33930; ADP-ribosylation factor-like tumor suppressor protein 1; MGC17429
• Gene ID: 115761
• mRNA Refseq: NM_138450
• Protein Refseq: NP_612459
• MIM: 609351
• UniProt ID: Q969Q4