Recombinant Human ARL10C protein, GST-tagged

• Cat.No.: ARL10C-803H
• Product Overview: Human ARL10C full-length ORF ( AAH13131, 1 a.a. - 186 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ARL8B (ADP Ribosylation Factor Like GTPase 8B) is a Protein Coding gene. GO annotations related to this gene include GTP binding and signal transducer activity. An important paralog of this gene is ARL8A.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46.2 kDa
• AA Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARL8B ADP-ribosylation factor-like 8B [ Homo sapiens ]
• Official Symbol: ARL8B
• Synonyms: ARL8B; ADP-ribosylation factor-like 8B; ADP ribosylation factor like 10C , ARL10C; ADP-ribosylation factor-like protein 8B; FLJ10702; Gie1; ADP-ribosylation factor-like 10C; ADP-ribosylation factor-like protein 10C; novel small G protein indispensable for equal chromosome segregation 1; ARL10C
• Gene ID: 55207
• mRNA Refseq: NM_018184
• Protein Refseq: NP_060654
• UniProt ID: Q9NVJ2