Recombinant Human ARID5B protein, GST-tagged

• Cat.No.: ARID5B-798H
• Product Overview: Human ARID5B partial ORF (XP_084482, 1483 a.a. - 1582 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the AT-rich interaction domain (ARID) family of DNA binding proteins. The encoded protein forms a histone H3K9Me2 demethylase complex with PHD finger protein 2 and regulates the transcription of target genes involved in adipogenesis and liver development. This gene also plays a role in cell growth and differentiation of B-lymphocyte progenitors, and single nucleotide polymorphisms in this gene are associated with acute lymphoblastic leukemia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
• Molecular Mass: 36.74 kDa
• AA Sequence: SGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAAINPQAAFPSSQLSSVHPSTKL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARID5B AT rich interactive domain 5B (MRF1-like) [ Homo sapiens ]
• Official Symbol: ARID5B
• Synonyms: ARID5B; AT rich interactive domain 5B (MRF1-like); AT-rich interactive domain-containing protein 5B; FLJ21150; MRF2; MRF1-like protein; ARID domain-containing protein 5B; modulator recognition factor 2 (MRF2); DESRT; MRF-2; FLJ41888
• Gene ID: 84159
• mRNA Refseq: NM_001244638
• Protein Refseq: NP_001231567
• MIM: 608538
• UniProt ID: Q14865