Name: Recombinant Human ARID1B protein, GST-tagged
SKU: ARID1B-793H

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	This locus encodes an AT-rich DNA interacting domain-containing protein. The encoded protein is a component of the SWI/SNF chromatin remodeling complex and may play a role in cell-cycle activation. The protein encoded by this locus is similar to AT-rich interactive domain-containing protein 1A. These two proteins function as alternative, mutually exclusive ARID-subunits of the SWI/SNF complex. The associated complexes play opposing roles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2016]
Molecular Mass :	36.41 kDa
AA Sequence :	PPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNR
Applications :	Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	ARID1B AT rich interactive domain 1B (SWI1-like) [ Homo sapiens ]
Official Symbol	ARID1B
Synonyms	ARID1B; AT rich interactive domain 1B (SWI1-like); AT-rich interactive domain-containing protein 1B; 6A3 5; BAF250b; DAN15; ELD/OSA1; KIAA1235; p250R; ELD (eyelid)/OSA protein; BRG1-associated factor 250b; BRG1-binding protein ELD/OSA1; ARID domain-containing protein 1B; OSA2; 6A3-5; MRD12; P250R; BRIGHT; BAF250B;
Gene ID	57492
mRNA Refseq	NM_017519
Protein Refseq	NP_059989
MIM	614556
UniProt ID	Q8NFD5