Recombinant Human ARID1A protein, His&Myc-tagged

• Cat.No.: ARID1A-2549H
• Product Overview: Recombinant Human ARID1A protein(O14497)(1976-2231aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.4 kDa
• Protein length: 1976-2231aa
• AA Sequence: SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ARID1A AT rich interactive domain 1A (SWI-like) [ Homo sapiens ]
• Official Symbol: ARID1A
• Synonyms: ARID1A; AT rich interactive domain 1A (SWI-like); AT rich interactive domain 1A (SWI like) , C1orf4, SMARCF1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; AT-rich interactive domain-containing protein 1A; B120; BAF250; BAF250a; C10rf4; P270; osa homolog 1; SWI-like protein; brain protein 120; OSA1 nuclear protein; BRG1-associated factor 250a; SWI/SNF complex protein p270; chromatin remodeling factor p250; ARID domain-containing protein 1A; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; ELD; OSA1; hELD; BM029; hOSA1; C1orf4; SMARCF1
• Gene ID: 8289
• mRNA Refseq: NM_006015
• Protein Refseq: NP_006006
• MIM: 603024
• UniProt ID: O14497