Recombinant Human ARID1A protein, His&Myc-tagged

Cat.No. : ARID1A-2201H
Product Overview : Recombinant Human ARID1A protein(O14497)(1976-2231aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His&Myc
Protein Length : 1976-2231aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 32.4 kDa
AA Sequence : SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name ARID1A AT rich interactive domain 1A (SWI-like) [ Homo sapiens ]
Official Symbol ARID1A
Synonyms ARID1A; AT rich interactive domain 1A (SWI-like); AT rich interactive domain 1A (SWI like) , C1orf4, SMARCF1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member 1; AT-rich interactive domain-containing protein 1A; B120; BAF250; BAF250a; C10rf4; P270; osa homolog 1; SWI-like protein; brain protein 120; OSA1 nuclear protein; BRG1-associated factor 250a; SWI/SNF complex protein p270; chromatin remodeling factor p250; ARID domain-containing protein 1A; SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1; ELD; OSA1; hELD; BM029; hOSA1; C1orf4; SMARCF1;
Gene ID 8289
mRNA Refseq NM_006015
Protein Refseq NP_006006
MIM 603024
UniProt ID O14497

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARID1A Products

Required fields are marked with *

My Review for All ARID1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon