Recombinant Human ARHGEF38 Protein, GST-tagged

• Cat.No.: ARHGEF38-4256H
• Product Overview: Human FLJ20184 full-length ORF (BAA90998.1, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ARHGEF38 (Rho Guanine Nucleotide Exchange Factor 38) is a Protein Coding gene. Among its related pathways are p75 NTR receptor-mediated signalling and Signaling by GPCR. GO annotations related to this gene include Rho guanyl-nucleotide exchange factor activity. An important paralog of this gene is DNMBP.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 51.9 kDa
• AA Sequence: MEPKEATGKENMVTKKKNLAFLRSRLYMLERRKTDTVVESSVSGDHSGTLRRSQSDRTEYNQKLQEKMTPRGECSVAETLTPEEEHHMKRMMAKREKIIKELIQTEKDYLNDLELCVREVVQPLRNKKTDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQIKGPLEDIYKIYCYHHDEAHSILESYEKEEELKEHLSHCIQSLK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGEF38 Rho guanine nucleotide exchange factor 38 [ Homo sapiens (human) ]
• Official Symbol: ARHGEF38
• Synonyms: ARHGEF38; Rho guanine nucleotide exchange factor 38; rho guanine nucleotide exchange factor 38; Rho guanine nucleotide exchange factor (GEF) 38
• Gene ID: 54848
• mRNA Refseq: NM_001242729
• Protein Refseq: NP_001229658
• UniProt ID: Q9NXL2