Recombinant Human ARHGEF16 protein, GST-tagged

Cat.No. : ARHGEF16-782H
Product Overview : Human ARHGEF16 full-length ORF ( NP_055263.1, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq, Jul 2008]
Molecular Mass : 75.1 kDa
AA Sequence : MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGEF16 Rho guanine nucleotide exchange factor (GEF) 16 [ Homo sapiens ]
Official Symbol ARHGEF16
Synonyms ARHGEF16; Rho guanine nucleotide exchange factor (GEF) 16; rho guanine nucleotide exchange factor 16; GEF16; NBR; putative neuroblastoma protein; ephexin-4; Rho guanine exchange factor (GEF) 16;
Gene ID 27237
mRNA Refseq NM_014448
Protein Refseq NP_055263
UniProt ID Q5VV41

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARHGEF16 Products

Required fields are marked with *

My Review for All ARHGEF16 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon