Recombinant Human ARHGEF10 protein, GST-tagged

• Cat.No.: ARHGEF10-779H
• Product Overview: Human ARHGEF10 partial ORF ( NP_055444, 792 a.a. - 890 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a Rho guanine nucleotide exchange factor (GEF). Rho GEFs regulate the activity of small Rho GTPases by stimulating the exchange of guanine diphosphate (GDP) for guanine triphosphate (GTP) and may play a role in neural morphogenesis. Mutations in this gene are associated with slowed nerve conduction velocity (SNCV). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: GKQDKSGRPTFFTAVFNTFTPAIKESWVNSLQMAKLALEEENHMGWFCVEDDGNHIKKEKHPLLVGHMPVMVAKQQEFKIECAAYNPEPYLNNESQPDS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGEF10 Rho guanine nucleotide exchange factor (GEF) 10 [ Homo sapiens ]
• Official Symbol: ARHGEF10
• Synonyms: ARHGEF10; Rho guanine nucleotide exchange factor (GEF) 10; rho guanine nucleotide exchange factor 10; Gef10; KIAA0294; GEF10; MGC131664; DKFZp686H0726
• Gene ID: 9639
• mRNA Refseq: NM_014629
• Protein Refseq: NP_055444
• MIM: 608136
• UniProt ID: O15013