Recombinant Human ARHGDIG
Cat.No. : | ARHGDIG-26234TH |
Product Overview : | Recombinant full length Human ARHGDIG with N-terminal proprietary tag. Predicted MW 50.86 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 225 amino acids |
Description : | The GDP-dissociation inhibitors (GDIs) play a primary role in modulating the activation of GTPases by inhibiting the exchange of GDP for GTP. See ARHGDIB (MIM 602843). |
Molecular Weight : | 50.860kDa inclusive of tags |
Tissue specificity : | Primarily expressed in pancreas and brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEV LDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPL PPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKD QVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRV DKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVS LFTDDDRTHHLSWEWGLCICQDWKD |
Sequence Similarities : | Belongs to the Rho GDI family. |
Gene Name | ARHGDIG Rho GDP dissociation inhibitor (GDI) gamma [ Homo sapiens ] |
Official Symbol | ARHGDIG |
Synonyms | ARHGDIG; Rho GDP dissociation inhibitor (GDI) gamma; rho GDP-dissociation inhibitor 3; RhoGDI gamma; RHOGDI 3; |
Gene ID | 398 |
mRNA Refseq | NM_001176 |
Protein Refseq | NP_001167 |
MIM | 602844 |
Uniprot ID | Q99819 |
Chromosome Location | 16p13.3 |
Pathway | G13 Signaling Pathway, organism-specific biosystem; Regulation of RhoA activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem; |
Function | GTPase activator activity; Rho GDP-dissociation inhibitor activity; |
◆ Recombinant Proteins | ||
ARHGDIG-26HF | Recombinant Full Length Human ARHGDIG Protein | +Inquiry |
ARHGDIG-1189HF | Recombinant Full Length Human ARHGDIG Protein, GST-tagged | +Inquiry |
ARHGDIG-617H | Recombinant Human ARHGDIG | +Inquiry |
ARHGDIG-2495H | Recombinant Human ARHGDIG Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGDIG-776H | Recombinant Human ARHGDIG protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGDIG-115HCL | Recombinant Human ARHGDIG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGDIG Products
Required fields are marked with *
My Review for All ARHGDIG Products
Required fields are marked with *
0
Inquiry Basket