Recombinant Human ARHGAP45 Protein, GST-tagged

Cat.No. : ARHGAP45-4883H
Product Overview : Human HMHA1 partial ORF ( AAH65223.1, 91 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ARHGAP45 (Rho GTPase Activating Protein 45) is a Protein Coding gene. Among its related pathways are Innate Immune System and Signaling by GPCR. An important paralog of this gene is ARHGAP29.
Molecular Mass : 36.74 kDa
AA Sequence : HRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLHDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ARHGAP45 Rho GTPase activating protein 45 [ Homo sapiens (human) ]
Official Symbol ARHGAP45
Synonyms ARHGAP45; Rho GTPase activating protein 45; HMHA1; histocompatibility (minor) HA-1; minor histocompatibility protein HA-1; ARHGAP45; HA 1; KIAA0223; minor histocompatibility antigen HA-1; HA-1; HLA-HA1;
Gene ID 23526
mRNA Refseq NM_001258328
Protein Refseq NP_001245257
MIM 601155
UniProt ID Q92619

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ARHGAP45 Products

Required fields are marked with *

My Review for All ARHGAP45 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon