Recombinant Human ARHGAP35, His-tagged
Cat.No. : | ARHGAP35-26370TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1055-1499 of Human GRLF1 isoform 2 with an N terminal His tag. Observed mwt: 59 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1055-1499 a.a. |
Description : | The human glucocorticoid receptor DNA binding factor, which associates with the promoter region of the glucocorticoid receptor gene (hGR gene), is a repressor of glucocorticoid receptor transcription. The amino acid sequence deduced from the cDNA sequences show the presence of three sequence motifs characteristic of a zinc finger and one motif suggestive of a leucine zipper in which 1 cysteine is found instead of all leucines. The GRLF1 enhances the homologous down-regulation of wild-type hGR gene expression. Biochemical analysis suggests that GRLF1 interaction is sequence specific and that transcriptional efficacy of GRLF1 is regulated through its interaction with specific sequence motif. The level of expression is regulated by glucocorticoids. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 113 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
Sequences of amino acids : | DLSYLDQGHRDGQRKSVSSSPWLPQDGFDPSDYAEPMDAV VKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGN GSDSEMDTSSLERGRKVSIVSKPVLYRTRCTRLGRFAS YRTSFSVGSDDELGPIRKKEEDQASQGYKGDNAVIPYE TDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFG VPLTTVVTPEKPIPIFIERCIEYIEATGLSTEGIYRVS GNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSF FSELPDPLVPYNMQIDLVEAHKINDREQKLHALKEVLK KFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICFWP TLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRP ITEPPGARPSSPSAVASTVPFLTSTPVTSQPSPPQSPP PTPQSPMQPLLPSQLQAEHTL |
Sequence Similarities : | Contains 4 FF domains.Contains 1 Rho-GAP domain. |
Gene Name | ARHGAP35 Rho GTPase activating protein 35 [ Homo sapiens ] |
Official Symbol | ARHGAP35 |
Synonyms | ARHGAP35; Rho GTPase activating protein 35; glucocorticoid receptor DNA binding factor 1 , GRLF1; rho GTPase-activating protein 35; GRF 1; KIAA1722; P190A; p190ARhoGAP; p190RhoGAP; |
Gene ID | 2909 |
mRNA Refseq | NM_004491 |
Protein Refseq | NP_004482 |
MIM | 605277 |
Uniprot ID | Q9NRY4 |
Chromosome Location | 19q13.32 |
Pathway | Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; EPHA2 forward signaling, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | DNA binding; GTP binding; GTPase activator activity; Rho GTPase activator activity; transcription corepressor activity; |
◆ Recombinant Proteins | ||
ARHGAP35-5578HF | Recombinant Full Length Human ARHGAP35 Protein, GST-tagged | +Inquiry |
ARHGAP35-26370TH | Recombinant Human ARHGAP35, His-tagged | +Inquiry |
ARHGAP35-26370H | Recombinant Human ARHGAP35 Protein, N-His tagged | +Inquiry |
ARHGAP35-5363H | Recombinant Human ARHGAP35 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP35 Products
Required fields are marked with *
My Review for All ARHGAP35 Products
Required fields are marked with *
0
Inquiry Basket