Recombinant Human ARHGAP29 protein, GST-tagged

• Cat.No.: ARHGAP29-769H
• Product Overview: Human ARHGAP29 partial ORF ( AAH93767.1, 12 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Rap1 is a small GTPase that, through effectors, regulates Rho GTPase signaling. These effectors- Rasip1, Radil, and the protein encoded by this gene- translocate to the cell membrane, where they form a multiprotein complex. This complex is necessary for Rap1-induced inhibition of Rho signaling. Defects in this gene may be a cause of nonsyndromic cleft lip with or without cleft palate. [provided by RefSeq, Jun 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: KRAWASGQLSTDITTSEMGLKSLSSNSIFDPDYIKELVNDIRKFSHMLLYLKEAIFSDCFKEVIHIRLEELLRVLKSIMNKHQNLNSVDLQNAAEMLTAK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGAP29 Rho GTPase activating protein 29 [ Homo sapiens ]
• Official Symbol: ARHGAP29
• Synonyms: ARHGAP29; Rho GTPase activating protein 29; rho GTPase-activating protein 29; PARG1; PTPL1-associated RhoGAP 1 (PARG1); PTPL1-associated RhoGAP protein 1; rho-type GTPase-activating protein 29; RP11-255E17.1
• Gene ID: 9411
• mRNA Refseq: NM_004815
• Protein Refseq: NP_004806
• MIM: 610496
• UniProt ID: Q52LW3