Recombinant Human ARHGAP22 protein, His-tagged
Cat.No. : | ARHGAP22-2795H |
Product Overview : | Recombinant Human ARHGAP22 protein(522-656 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 522-656 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARHGAP22 Rho GTPase activating protein 22 [ Homo sapiens ] |
Official Symbol | ARHGAP22 |
Synonyms | ARHGAP22; Rho GTPase activating protein 22; rho GTPase-activating protein 22; RhoGAP2; rho-type GTPase-activating protein 22; RhoGap22; |
Gene ID | 58504 |
mRNA Refseq | NM_001256024 |
Protein Refseq | NP_001242953 |
MIM | 610585 |
UniProt ID | Q7Z5H3 |
◆ Recombinant Proteins | ||
ARHGAP22-674M | Recombinant Mouse ARHGAP22 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARHGAP22-2578H | Recombinant Human ARHGAP22 Protein, His-tagged | +Inquiry |
ARHGAP22-2795H | Recombinant Human ARHGAP22 protein, His-tagged | +Inquiry |
Arhgap22-1681M | Recombinant Mouse Arhgap22 Protein, Myc/DDK-tagged | +Inquiry |
ARHGAP22-5860H | Recombinant Human ARHGAP22 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARHGAP22 Products
Required fields are marked with *
My Review for All ARHGAP22 Products
Required fields are marked with *
0
Inquiry Basket