Recombinant Human ARHGAP22 protein, GST-tagged

• Cat.No.: ARHGAP22-301205H
• Product Overview: Recombinant Human ARHGAP22 (522-656 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Ser522-Glu656
• AA Sequence: SVASMAWSGASSSESSVGGSLSSCTACRASDSSARSSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQGLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEE
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ARHGAP22 Rho GTPase activating protein 22 [ Homo sapiens ]
• Official Symbol: ARHGAP22
• Synonyms: ARHGAP22; Rho GTPase activating protein 22; rho GTPase-activating protein 22; RhoGAP2; rho-type GTPase-activating protein 22; RhoGap22
• Gene ID: 58504
• mRNA Refseq: NM_001256024
• Protein Refseq: NP_001242953
• MIM: 610585
• UniProt ID: Q7Z5H3