Recombinant Human ARG1 protein(21-90 aa), C-His-tagged

• Cat.No.: ARG1-2553H
• Product Overview: Recombinant Human ARG1 protein(P05089)(21-90 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 21-90 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: RGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKN
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ARG1 arginase, liver [ Homo sapiens ]
• Official Symbol: ARG1
• Synonyms: ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase
• Gene ID: 383
• mRNA Refseq: NM_000045
• Protein Refseq: NP_000036
• MIM: 608313
• UniProt ID: P05089