Recombinant Human ARG1 Protein
Cat.No. : | ARG1-812H |
Product Overview : | Recombinant human ARG1 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 322 |
Description : | Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 35.6 kDa |
AA Sequence : | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | ARG1 arginase, liver [ Homo sapiens (human) ] |
Official Symbol | ARG1 |
Synonyms | ARG1; arginase, liver; arginase-1; type I arginase; liver-type arginase; |
Gene ID | 383 |
mRNA Refseq | NM_000045 |
Protein Refseq | NP_000036 |
MIM | 608313 |
UniProt ID | P05089 |
◆ Native Proteins | ||
Arg1-8044R | Native Rat Liver Arginase | +Inquiry |
Arg1-150R | Active Native Rat Arginase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG1-1869HCL | Recombinant Human ARG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARG1 Products
Required fields are marked with *
My Review for All ARG1 Products
Required fields are marked with *
0
Inquiry Basket